SCOP 1.73: Domain d1veha_: 1veh A:

Lineage for d1veha_ (1veh A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (8 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (2 families)
   similar putative active site with a conserved cysteine residue

5. Family d.52.8.1: NifU C-terminal domain-like [117917] (3 proteins)
   Pfam PF01106

6. Protein HIRA-interacting protein 5, HIRIP5 [117918] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117919] (1 PDB entry)

8. Domain d1veha_: 1veh A: [113635]
   Structural genomics target

Details for d1veha_

PDB Entry: 1veh

PDB Description: solution structure of rsgi ruh-018, a nifu-like domain of hirip5 protein from mouse cdna

PDB Compounds: (A:) NifU-like protein HIRIP5

SCOP Domain Sequences for d1veha_:

Sequence; same for both SEQRES and ATOM records:

>d1veha_ d.52.8.1 (A:) HIRA-interacting protein 5, HIRIP5 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgseeddevvamikelldtrirptvqedggdviyrgfedgivrlklqgsctscps
siitlksgiqnmlqfyipevegveqvsgpssg

Timeline for d1veha_:

• d1veha_ first appeared in SCOP 1.71
  
• d1veha_ appears in SCOP 1.75
  
• d1veha_ appears in the current release, SCOPe 2.08, called d1veha1