Lineage for d1vdva2 (1vdv A:3-92)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1195552Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1195703Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins)
  6. 1195802Protein Xanthine oxidase, N-terminal domain [54318] (1 species)
  7. 1195803Species Cow (Bos taurus) [TaxId:9913] [54319] (6 PDB entries)
    Uniprot P80457
  8. 1195806Domain d1vdva2: 1vdv A:3-92 [113615]
    Other proteins in same PDB: d1vdva1, d1vdva3, d1vdva4, d1vdva5, d1vdva6, d1vdvb1, d1vdvb3, d1vdvb4, d1vdvb5, d1vdvb6
    complexed with acy, ca, fad, fes, gol, mos, mte, ysh

Details for d1vdva2

PDB Entry: 1vdv (more details), 1.98 Å

PDB Description: Bovine Milk Xanthine Dehydrogenase Y-700 Bound Form
PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d1vdva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdva2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
dkiihfsanaclapictlhhvavttvegig

SCOPe Domain Coordinates for d1vdva2:

Click to download the PDB-style file with coordinates for d1vdva2.
(The format of our PDB-style files is described here.)

Timeline for d1vdva2: