Lineage for d1vb8a_ (1vb8 A:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747189Superfamily g.3.3: Cyclotides [57038] (4 families) (S)
    macrocyclic plant knottins closed with the formation of an Asn-Gly peptide
  5. 747201Family g.3.3.2: Cycloviolacin [57042] (2 proteins)
  6. 747206Protein Root cyclotide 1 [118231] (1 species)
  7. 747207Species Australian violet (Viola hederacea) [TaxId:180952] [118232] (1 PDB entry)
  8. 747208Domain d1vb8a_: 1vb8 A: [113606]
    by homology with the Kalata B1 linear precursor, the mature protein sequence probably begins at Gly28 and ends at Asn27

Details for d1vb8a_

PDB Entry: 1vb8 (more details)

PDB Description: solution structure of vhr1, the first cyclotide from root tissue
PDB Compounds: (A:) Viola hederacea root peptide 1

SCOP Domain Sequences for d1vb8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vb8a_ g.3.3.2 (A:) Root cyclotide 1 {Australian violet (Viola hederacea) [TaxId: 180952]}
caescvwipctvtallgcscsnkvcyngip

SCOP Domain Coordinates for d1vb8a_:

Click to download the PDB-style file with coordinates for d1vb8a_.
(The format of our PDB-style files is described here.)

Timeline for d1vb8a_: