Class g: Small proteins [56992] (85 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.3: Cyclotides [57038] (4 families) macrocyclic plant knottins closed with the formation of an Asn-Gly peptide |
Family g.3.3.2: Cycloviolacin [57042] (2 proteins) |
Protein Root cyclotide 1 [118231] (1 species) |
Species Australian violet (Viola hederacea) [TaxId:180952] [118232] (1 PDB entry) |
Domain d1vb8a_: 1vb8 A: [113606] by homology with the Kalata B1 linear precursor, the mature protein sequence probably begins at Gly28 and ends at Asn27 |
PDB Entry: 1vb8 (more details)
SCOP Domain Sequences for d1vb8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vb8a_ g.3.3.2 (A:) Root cyclotide 1 {Australian violet (Viola hederacea) [TaxId: 180952]} caescvwipctvtallgcscsnkvcyngip
Timeline for d1vb8a_: