Lineage for d1v78a_ (1v78 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572244Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 572245Family c.1.9.1: Adenosine deaminase (ADA) [51557] (1 protein)
  6. 572246Protein Adenosine deaminase (ADA) [51558] (2 species)
    Common fold covers the whole protein structure
  7. 572247Species Cow (Bos taurus) [TaxId:9913] [82257] (12 PDB entries)
  8. 572255Domain d1v78a_: 1v78 A: [113558]
    complexed with fr6, zn

Details for d1v78a_

PDB Entry: 1v78 (more details), 2.5 Å

PDB Description: Crystal structures of adenosine deaminase complexed with potent inhibitors

SCOP Domain Sequences for d1v78a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v78a_ c.1.9.1 (A:) Adenosine deaminase (ADA) {Cow (Bos taurus)}
tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeelqniigmdkpltlpdfla
kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayr

SCOP Domain Coordinates for d1v78a_:

Click to download the PDB-style file with coordinates for d1v78a_.
(The format of our PDB-style files is described here.)

Timeline for d1v78a_:

  • d1v78a_ is new in SCOP 1.71
  • d1v78a_ does not appear in SCOP 1.73