SCOP 1.71: Domain d1v70a_: 1v70 A:

Lineage for d1v70a_ (1v70 A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (16 families)

5. Family b.82.1.9: TM1287-like [89409] (2 proteins)

6. Protein Hypothetical protein TTHA0104 [117310] (1 species)

7. Species Thermus thermophilus [TaxId:274] [117311] (1 PDB entry)

8. Domain d1v70a_: 1v70 A: [113555]
   Structural genomics target
   complexed with na

Details for d1v70a_

PDB Entry: 1v70, 1.3 Å

PDB Description: Crystal Structure of probable antibiotics synthesis protein from Thermus thermophilus HB8

SCOP Domain Sequences for d1v70a_:

Sequence; same for both SEQRES and ATOM records:

>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus}
meikdlkrlarynpekmakipvfqsermlydlyallpgqaqkvhvhegsdkvyyalegev
vvrvgeeeallapgmaafapagaphgvrnesaspalllvvtaprp

Timeline for d1v70a_:

• d1v70a_ is new in SCOP 1.71
  
• d1v70a_ appears in SCOP 1.73
  
• d1v70a_ appears in the current release, SCOPe 2.08