Lineage for d1v6ea_ (1v6e A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 598489Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 598490Family d.15.1.1: Ubiquitin-related [54237] (26 proteins)
    Pfam 00240
  6. 598610Protein Ubiquitin-like domain of tubulin folding cofactor B [102786] (2 species)
  7. 598611Species Mouse (Mus musculus) [TaxId:10090] [117798] (1 PDB entry)
  8. 598612Domain d1v6ea_: 1v6e A: [113547]
    mutant

Details for d1v6ea_

PDB Entry: 1v6e (more details)

PDB Description: Solution Structure of a N-terminal Ubiquitin-like Domain in Mouse Tubulin-specific Chaperone B

SCOP Domain Sequences for d1v6ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus)}
gssgssgvmvfissslnsfrsekrysrsltiaefkcklelvvgspascmelelygaddkf
yskldqedallgsypvddgcrihvidhsgsgpssg

SCOP Domain Coordinates for d1v6ea_:

Click to download the PDB-style file with coordinates for d1v6ea_.
(The format of our PDB-style files is described here.)

Timeline for d1v6ea_: