Lineage for d1v6ea1 (1v6e A:8-89)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. Protein Ubiquitin-like domain of tubulin folding cofactor B [102786] (2 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [117798] (1 PDB entry)
    Uniprot Q9D1E6 11-92
  8. Domain d1v6ea1: 1v6e A:8-89 [113547]
    Other proteins in same PDB: d1v6ea2, d1v6ea3

Details for d1v6ea1

PDB Entry: 1v6e (more details)

PDB Description: Solution Structure of a N-terminal Ubiquitin-like Domain in Mouse Tubulin-specific Chaperone B
PDB Compounds: (A:) cytoskeleton-associated protein 1

SCOPe Domain Sequences for d1v6ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6ea1 d.15.1.1 (A:8-89) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]}
vmvfissslnsfrsekrysrsltiaefkcklelvvgspascmelelygaddkfyskldqe
dallgsypvddgcrihvidhsg

SCOPe Domain Coordinates for d1v6ea1 are not available.

Timeline for d1v6ea1:

Domains from same chain:
(mouse over for more information)
d1v6ea2, d1v6ea3