SCOPe 2.08: Domain d1v6ea1: 1v6e A:8-89

Lineage for d1v6ea1 (1v6e A:8-89)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein Ubiquitin-like domain of tubulin folding cofactor B [102786] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117798] (1 PDB entry)
   Uniprot Q9D1E6 11-92

8. Domain d1v6ea1: 1v6e A:8-89 [113547]
   Other proteins in same PDB: d1v6ea2, d1v6ea3

Details for d1v6ea1

PDB Entry: 1v6e

PDB Description: solution structure of a n-terminal ubiquitin-like domain in mouse tubulin-specific chaperone b

PDB Compounds: (A:) cytoskeleton-associated protein 1

SCOPe Domain Sequences for d1v6ea1:

Sequence; same for both SEQRES and ATOM records:

>d1v6ea1 d.15.1.1 (A:8-89) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]}
vmvfissslnsfrsekrysrsltiaefkcklelvvgspascmelelygaddkfyskldqe
dallgsypvddgcrihvidhsg

Timeline for d1v6ea1:

• d1v6ea1 first appeared in SCOP 1.71, called d1v6ea_
  
• d1v6ea1 appears in SCOPe 2.07