Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Ubiquitin-like domain of tubulin folding cofactor B [102786] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117798] (1 PDB entry) Uniprot Q9D1E6 11-92 |
Domain d1v6ea1: 1v6e A:8-89 [113547] Other proteins in same PDB: d1v6ea2, d1v6ea3 |
PDB Entry: 1v6e (more details)
SCOPe Domain Sequences for d1v6ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v6ea1 d.15.1.1 (A:8-89) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} vmvfissslnsfrsekrysrsltiaefkcklelvvgspascmelelygaddkfyskldqe dallgsypvddgcrihvidhsg
Timeline for d1v6ea1: