SCOPe 2.04: Domain d1v40c2: 1v40 C:402-475

Lineage for d1v40c2 (1v40 C:402-475)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class sigma GST [81362] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89705] (7 PDB entries)
   Uniprot O60760
   synonym: hematopoietic prostaglandin D synthase

8. Domain d1v40c2: 1v40 C:402-475 [113517]
   Other proteins in same PDB: d1v40a1, d1v40b1, d1v40c1, d1v40d1
   complexed with gol, gsh, mg, o16

Details for d1v40c2

PDB Entry: 1v40, 1.9 Å

PDB Description: First Inhibitor Complex Structure of Human Hematopoietic Prostaglandin D Synthase

PDB Compounds: (C:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d1v40c2:

Sequence; same for both SEQRES and ATOM records:

>d1v40c2 c.47.1.5 (C:402-475) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

Timeline for d1v40c2:

• d1v40c2 first appeared in SCOP 1.71
  
• d1v40c2 appears in SCOPe 2.03
  
• d1v40c2 appears in SCOPe 2.05
  
• d1v40c2 appears in the current release, SCOPe 2.08