Class a: All alpha proteins [46456] (226 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins) |
Protein Class sigma GST [81351] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [89061] (3 PDB entries) |
Domain d1v40c1: 1v40 C:476-599 [113516] Other proteins in same PDB: d1v40a2, d1v40b2, d1v40c2, d1v40d2 |
PDB Entry: 1v40 (more details), 1.9 Å
SCOP Domain Sequences for d1v40c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v40c1 a.45.1.1 (C:476-599) Class sigma GST {Human (Homo sapiens)} dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp qtkl
Timeline for d1v40c1: