SCOPe 2.06: Domain d1v3aa_: 1v3a A:

Lineage for d1v3aa_ (1v3a A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)

6. Protein Protein tyrosine phosphatase type IVa [102418] (3 species)

7. Species Human (Homo sapiens), pr-3 [TaxId:9606] [102419] (4 PDB entries)
   Uniprot O75365 1-162 # 99% sequence identity

8. Domain d1v3aa_: 1v3a A: [113499]

Details for d1v3aa_

PDB Entry: 1v3a

PDB Description: structure of human prl-3, the phosphatase associated with cancer metastasis

PDB Compounds: (A:) protein tyrosine phosphatase type IVA

SCOPe Domain Sequences for d1v3aa_:

Sequence; same for both SEQRES and ATOM records:

>d1v3aa_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-3 [TaxId: 9606]}
marmnrpapvevsykhmrflithnptnatlstfiedlkkygattvvrvcevtydktplek
dgitvvdwpfddgapppgkvvedwlslvkakfceapgscvavhcvaglgrapvlvalali
esgmkyedaiqfirqkrrgainskqltylekyrpkqrlrfkd

Timeline for d1v3aa_:

• d1v3aa_ first appeared in SCOP 1.71
  
• d1v3aa_ appears in SCOPe 2.05
  
• d1v3aa_ appears in SCOPe 2.07
  
• d1v3aa_ appears in the current release, SCOPe 2.08