Lineage for d1v3aa_ (1v3a A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584246Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 584247Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (4 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 584248Family c.45.1.1: Dual specificity phosphatase-like [52800] (8 proteins)
  6. 584278Protein Protein tyrosine phosphatase type IVa [102418] (2 species)
  7. 584283Species Human (Homo sapiens), pr-3 [TaxId:9606] [102419] (2 PDB entries)
  8. 584285Domain d1v3aa_: 1v3a A: [113499]

Details for d1v3aa_

PDB Entry: 1v3a (more details)

PDB Description: structure of human prl-3, the phosphatase associated with cancer metastasis

SCOP Domain Sequences for d1v3aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3aa_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-3}
marmnrpapvevsykhmrflithnptnatlstfiedlkkygattvvrvcevtydktplek
dgitvvdwpfddgapppgkvvedwlslvkakfceapgscvavhcvaglgrapvlvalali
esgmkyedaiqfirqkrrgainskqltylekyrpkqrlrfkd

SCOP Domain Coordinates for d1v3aa_:

Click to download the PDB-style file with coordinates for d1v3aa_.
(The format of our PDB-style files is described here.)

Timeline for d1v3aa_: