SCOPe 2.08: Domain d1v05a1: 1v05 A:2633-2725

Lineage for d1v05a1 (1v05 A:2633-2725)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
   Pfam PF00630

6. Protein Filamin C [117049] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117050] (6 PDB entries)
   Uniprot Q14315 2633-2725

8. Domain d1v05a1: 1v05 A:2633-2725 [113465]
   Other proteins in same PDB: d1v05a2
   24th, C-terminal repeat

Details for d1v05a1

PDB Entry: 1v05, 1.43 Å

PDB Description: dimerization of human filamin c: crystal structure of the domain 24

PDB Compounds: (A:) filamin c

SCOPe Domain Sequences for d1v05a1:

Sequence; same for both SEQRES and ATOM records:

>d1v05a1 b.1.18.10 (A:2633-2725) Filamin C {Human (Homo sapiens) [TaxId: 9606]}
sdaskvvtrgpglsqafvgqknsftvdcskagtnmmmvgvhgpktpceevyvkhmgnrvy
nvtytvkekgdyilivkwgdesvpgspfkvkvp

Timeline for d1v05a1:

• d1v05a1 first appeared in SCOP 1.71, called d1v05a_
  
• d1v05a1 was called d1v05a_ in SCOPe 2.07