SCOP 1.73: Domain d1uxwa2: 1uxw A:1-181

Lineage for d1uxwa2 (1uxw A:1-181)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)

7. Species Human (Homo sapiens), HLA-B27 [TaxId:9606] [54471] (8 PDB entries)

8. Domain d1uxwa2: 1uxw A:1-181 [113454]
   Other proteins in same PDB: d1uxwa1, d1uxwb_
   complexed with gol

Details for d1uxwa2

PDB Entry: 1uxw, 1.71 Å

PDB Description: crystal structure of hla-b*2709 complexed with the latent membrane protein 2 peptide (lmp2) of epstein-barr virus

PDB Compounds: (A:) hla class I histocompatibility antigen b-27 alpha chain

SCOP Domain Sequences for d1uxwa2:

Sequence; same for both SEQRES and ATOM records:

>d1uxwa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B27 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqhaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

Timeline for d1uxwa2:

• d1uxwa2 first appeared in SCOP 1.71
  
• d1uxwa2 appears in SCOP 1.75
  
• d1uxwa2 appears in the current release, SCOPe 2.08