Lineage for d1uxsa2 (1uxs A:1-181)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897285Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1897478Species Human (Homo sapiens), HLA-B27 [TaxId:9606] [54471] (9 PDB entries)
    Uniprot P03989 25-300
  8. 1897481Domain d1uxsa2: 1uxs A:1-181 [113451]
    Other proteins in same PDB: d1uxsa1, d1uxsb_
    complexed with gol

Details for d1uxsa2

PDB Entry: 1uxs (more details), 1.55 Å

PDB Description: crystal structure of hla-b*2705 complexed with the latent membrane protein 2 peptide (lmp2)of epstein-barr virus
PDB Compounds: (A:) hla class I histocompatibility antigen b-27 alpha chain

SCOPe Domain Sequences for d1uxsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxsa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B27 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

SCOPe Domain Coordinates for d1uxsa2:

Click to download the PDB-style file with coordinates for d1uxsa2.
(The format of our PDB-style files is described here.)

Timeline for d1uxsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uxsa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1uxsb_