Lineage for d1uxsa2 (1uxs A:1-181)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600255Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 600336Species Human (Homo sapiens), HLA-B27 [TaxId:9606] [54471] (8 PDB entries)
  8. 600339Domain d1uxsa2: 1uxs A:1-181 [113451]
    Other proteins in same PDB: d1uxsa1, d1uxsb_
    complexed with gol

Details for d1uxsa2

PDB Entry: 1uxs (more details), 1.55 Å

PDB Description: crystal structure of hla-b*2705 complexed with the latent membrane protein 2 peptide (lmp2)of epstein-barr virus

SCOP Domain Sequences for d1uxsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxsa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B27}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

SCOP Domain Coordinates for d1uxsa2:

Click to download the PDB-style file with coordinates for d1uxsa2.
(The format of our PDB-style files is described here.)

Timeline for d1uxsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uxsa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1uxsb_