Lineage for d1utzb_ (1utz B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1034471Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1034472Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1034832Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1034947Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 1034948Species Human (Homo sapiens) [TaxId:9606] [69781] (29 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 1034994Domain d1utzb_: 1utz B: [113432]
    complexed with ca, hae, pf3, zn

Details for d1utzb_

PDB Entry: 1utz (more details), 2.5 Å

PDB Description: crystal structure of mmp-12 complexed to (2r)-3-({[4-[(pyridin-4-yl) phenyl]-thien-2-yl}carboxamido)(phenyl)propanoic acid
PDB Compounds: (B:) Macrophage metalloelastase

SCOPe Domain Sequences for d1utzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utzb_ d.92.1.11 (B:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslygd

SCOPe Domain Coordinates for d1utzb_:

Click to download the PDB-style file with coordinates for d1utzb_.
(The format of our PDB-style files is described here.)

Timeline for d1utzb_: