Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
Protein N-terminal domain of sialoadhesin [48732] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [48733] (7 PDB entries) Uniprot Q62230 20-130 |
Domain d1urla_: 1url A: [113412] complexed with hia, sia |
PDB Entry: 1url (more details), 2.4 Å
SCOP Domain Sequences for d1urla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1urla_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvtt
Timeline for d1urla_: