Class a: All alpha proteins [46456] (289 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries) Uniprot P20248 175-432 |
Domain d1urcd2: 1urc D:310-432 [113409] Other proteins in same PDB: d1urca_, d1urcc_ |
PDB Entry: 1urc (more details), 2.6 Å
SCOPe Domain Sequences for d1urcd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1urcd2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet lnl
Timeline for d1urcd2:
View in 3D Domains from other chains: (mouse over for more information) d1urca_, d1urcb1, d1urcb2, d1urcc_ |