SCOPe 2.01: Domain d1ur4b_: 1ur4 B:

Lineage for d1ur4b_ (1ur4 B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Beta-1,4-galactanase [89469] (4 species)

7. Species Bacillus licheniformis [TaxId:1402] [117367] (4 PDB entries)
   Uniprot Q65CX5 36-422 ! Uniprot Q65CX5 28-424

8. Domain d1ur4b_: 1ur4 B: [113403]
   complexed with b2g, ca, peg, pge

Details for d1ur4b_

PDB Entry: 1ur4, 2.2 Å

PDB Description: the structure of endo-beta-1,4-galactanase from bacillus licheniformis in complex with two oligosaccharide products.

PDB Compounds: (B:) galactanase

SCOPe Domain Sequences for d1ur4b_:

Sequence; same for both SEQRES and ATOM records:

>d1ur4b_ c.1.8.3 (B:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]}
glyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkeagvnyvrvriw
ndpydangngygggnndlekaiqigkratangmklladfhysdfwadpakqkapkawanl
nfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakmsqlfnagsqav
retdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgtlknltsvlts
vadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanavrdviqavsdv
geagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpedagkwfggsavd
nqalfdfkgrplpslhvfqyvdtgtpfk

Timeline for d1ur4b_:

• d1ur4b_ first appeared in SCOP 1.71
  
• d1ur4b_ appears in SCOP 1.75
  
• d1ur4b_ appears in SCOPe 2.02
  
• d1ur4b_ appears in the current release, SCOPe 2.08