SCOPe 2.04: Domain d1unha_: 1unh A:

Lineage for d1unha_ (1unh A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK5 [88857] (1 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88858] (5 PDB entries)
   Uniprot Q00535

8. Domain d1unha_: 1unh A: [113320]
   Other proteins in same PDB: d1unhd_, d1unhe_
   complexed with ixm

Details for d1unha_

PDB Entry: 1unh, 2.35 Å

PDB Description: structural mechanism for the inhibition of cdk5-p25 by roscovitine, aloisine and indirubin.

PDB Compounds: (A:) cyclin-dependent kinase 5

SCOPe Domain Sequences for d1unha_:

Sequence, based on SEQRES records:

>d1unha_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]}
qkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkhk
nivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrn
vlhrdlkpqnllinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklyst
sidmwsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypm
ypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsd

Sequence, based on observed residues (ATOM records):

>d1unha_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]}
qkyeklekiygtvfkaknrheivalkrvrldgvpssalreicllkelkhknivrlhdvlh
sdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrnvlhrdlkpqn
llinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklystsidmwsagci
faelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypmypattslvnv
vpklnatgrdllqnllkcnpvqrisaeealqhpyfsd

Timeline for d1unha_:

• d1unha_ first appeared in SCOP 1.71
  
• d1unha_ appears in SCOPe 2.03
  
• d1unha_ appears in SCOPe 2.05
  
• d1unha_ appears in the current release, SCOPe 2.08