Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (100 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1um6l2: 1um6 L:110-217 [113309] Other proteins in same PDB: d1um6h1, d1um6h2, d1um6l1 |
PDB Entry: 1um6 (more details), 1.8 Å
SCOP Domain Sequences for d1um6l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1um6l2 b.1.1.2 (L:110-217) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgecg
Timeline for d1um6l2: