Lineage for d1um6h2 (1um6 H:120-219)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1292198Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1292202Species Human (Homo sapiens) [TaxId:9606] [88575] (177 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 1292225Domain d1um6h2: 1um6 H:120-219 [113307]
    Other proteins in same PDB: d1um6h1, d1um6l1, d1um6l2

Details for d1um6h2

PDB Entry: 1um6 (more details), 1.8 Å

PDB Description: catalytic antibody 21h3
PDB Compounds: (H:) antibody 21h3, H chain

SCOPe Domain Sequences for d1um6h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1um6h2 b.1.1.2 (H:120-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d1um6h2:

Click to download the PDB-style file with coordinates for d1um6h2.
(The format of our PDB-style files is described here.)

Timeline for d1um6h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1um6h1