SCOPe 2.06: Domain d1ulya_: 1uly A:

Lineage for d1ulya_ (1uly A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.58: Hypothetical protein PH1932 [116798] (1 protein)
   contains new dimerisation all-alpha C-terminal subdomain

6. Protein Hypothetical protein PH1932 [116799] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [116800] (2 PDB entries)
   Uniprot O59595

8. Domain d1ulya_: 1uly A: [113297]

Details for d1ulya_

PDB Entry: 1uly, 2.5 Å

PDB Description: Crystal structure analysis of the ArsR homologue DNA-binding protein from P. horikoshii OT3

PDB Compounds: (A:) hypothetical protein PH1932

SCOPe Domain Sequences for d1ulya_:

Sequence; same for both SEQRES and ATOM records:

>d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]}
akkvkvitdpevikvmledtrrkilkllrnkemtisqlseilgktpqtiyhhieklkeag
lvevkrtemkgnlvekyygrtadvfyinlylgdeelryiarsrlktkidifkrlgyqfee
nellnimdrmsqkefdatvriskyieekedalkdfsnediihaiewlstaelardeeyle
llkrlgsilk

Timeline for d1ulya_:

• d1ulya_ first appeared in SCOP 1.71
  
• d1ulya_ appears in SCOPe 2.05
  
• d1ulya_ appears in SCOPe 2.07
  
• d1ulya_ appears in the current release, SCOPe 2.08