Lineage for d1ulya_ (1uly A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694297Family a.4.5.58: Hypothetical protein PH1932 [116798] (1 protein)
    contains new dimerisation all-alpha C-terminal subdomain
  6. 2694298Protein Hypothetical protein PH1932 [116799] (1 species)
  7. 2694299Species Pyrococcus horikoshii [TaxId:53953] [116800] (2 PDB entries)
    Uniprot O59595
  8. 2694300Domain d1ulya_: 1uly A: [113297]

Details for d1ulya_

PDB Entry: 1uly (more details), 2.5 Å

PDB Description: Crystal structure analysis of the ArsR homologue DNA-binding protein from P. horikoshii OT3
PDB Compounds: (A:) hypothetical protein PH1932

SCOPe Domain Sequences for d1ulya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]}
akkvkvitdpevikvmledtrrkilkllrnkemtisqlseilgktpqtiyhhieklkeag
lvevkrtemkgnlvekyygrtadvfyinlylgdeelryiarsrlktkidifkrlgyqfee
nellnimdrmsqkefdatvriskyieekedalkdfsnediihaiewlstaelardeeyle
llkrlgsilk

SCOPe Domain Coordinates for d1ulya_:

Click to download the PDB-style file with coordinates for d1ulya_.
(The format of our PDB-style files is described here.)

Timeline for d1ulya_: