Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins) |
Protein Medium chain acyl-CoA dehydrogenase, NM domains [56649] (3 species) |
Species Thermus thermophilus [TaxId:274] [118186] (1 PDB entry) Uniprot Q5SJ70 32-409 |
Domain d1ukwa2: 1ukw A:32-258 [113264] Other proteins in same PDB: d1ukwa1, d1ukwb1 complexed with co, fad |
PDB Entry: 1ukw (more details), 2.4 Å
SCOPe Domain Sequences for d1ukwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ukwa2 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydrogenase, NM domains {Thermus thermophilus [TaxId: 274]} idfslteeqrqlqalarrfakevilpvaqeydekeevpwpvieklhevgllnaiipeeyg gmglkmldevivgeelayacmgiytipmasdlgitpvllagteeqkerflrpltekpala afalsepgngsdaaalktrairqgdhyvlngtkmwisnggeaewvvvfatvnpelrhkgv valvvergtpgfkaikihgkmgqrasgtyelvfedvkvpvenrlgee
Timeline for d1ukwa2: