SCOP 1.71: Domain d1u92b2: 1u92 B:114-215

Lineage for d1u92b2 (1u92 B:114-215)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (105 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1u92b2: 1u92 B:114-215 [113223]
   Other proteins in same PDB: d1u92a1, d1u92a2, d1u92b1

Details for d1u92b2

PDB Entry: 1u92, 2.24 Å

PDB Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide Analog E-[Dap]-DKWQS (cyclic)

SCOP Domain Sequences for d1u92b2:

Sequence, based on SEQRES records:

>d1u92b2 b.1.1.2 (B:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
tstkgpsvfplapsskstaggaaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvepks

Sequence, based on observed residues (ATOM records):

>d1u92b2 b.1.1.2 (B:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
tstkgpsvfplapaaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
vtvpssslqtytcnvnhkpsntkvdkrvepks

Timeline for d1u92b2:

• d1u92b2 is new in SCOP 1.71
  
• d1u92b2 appears in SCOP 1.73
  
• d1u92b2 appears in the current release, SCOPe 2.08