Lineage for d1u91b1 (1u91 B:1-113)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755653Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1755657Species Engineered (including hybrid species) [88562] (68 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 1755690Domain d1u91b1: 1u91 B:1-113 [113218]
    Other proteins in same PDB: d1u91a1, d1u91a2, d1u91b2

Details for d1u91b1

PDB Entry: 1u91 (more details), 2.24 Å

PDB Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide Analog ENDKW-[Dap]-S (cyclic)
PDB Compounds: (B:) antibody 2f5 (heavy chain)

SCOPe Domain Sequences for d1u91b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u91b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
vwgqgitvtiss

SCOPe Domain Coordinates for d1u91b1:

Click to download the PDB-style file with coordinates for d1u91b1.
(The format of our PDB-style files is described here.)

Timeline for d1u91b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u91b2