SCOP 1.71: Domain d1u90b_: 1u90 B:

Lineage for d1u90b_ (1u90 B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ras-related protein RalA [89662] (2 species)

7. Species Cotton-top tamarin (Saguinus oedipus) [TaxId:9490] [117532] (3 PDB entries)

8. Domain d1u90b_: 1u90 B: [113215]
   complexed with gdp, mg

Details for d1u90b_

PDB Entry: 1u90, 2 Å

PDB Description: crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap

SCOP Domain Sequences for d1u90b_:

Sequence; same for both SEQRES and ATOM records:

>d1u90b_ c.37.1.8 (B:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus)}
alhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildtagq
edyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksdle
dkrqvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar

Timeline for d1u90b_:

• d1u90b_ is new in SCOP 1.71
  
• d1u90b_ appears in SCOP 1.73
  
• d1u90b_ appears in the current release, SCOPe 2.08