SCOP 1.75: Domain d1u8td_: 1u8t D:

Lineage for d1u8td_ (1u8t D:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (7 families)

5. Family c.23.1.1: CheY-related [52173] (25 proteins)

6. Protein CheY protein [52174] (4 species)

7. Species Escherichia coli [TaxId:562] [52175] (33 PDB entries)
   Uniprot P06143

8. Domain d1u8td_: 1u8t D: [113195]
   complexed with so4; mutant

Details for d1u8td_

PDB Entry: 1u8t, 1.5 Å

PDB Description: crystal structure of chey d13k y106w alone and in complex with a flim peptide

PDB Compounds: (D:) Chemotaxis protein cheY

SCOP Domain Sequences for d1u8td_:

Sequence; same for both SEQRES and ATOM records:

>d1u8td_ c.23.1.1 (D:) CheY protein {Escherichia coli [TaxId: 562]}
adkelkflvvdkfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgwvvkpftaatleekln
kifeklgm

Timeline for d1u8td_:

• d1u8td_ first appeared in SCOP 1.71
  
• d1u8td_ appears in SCOP 1.73
  
• d1u8td_ appears in SCOPe 2.01
  
• d1u8td_ appears in the current release, SCOPe 2.08