Lineage for d1u8qb2 (1u8q B:114-216)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760578Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1760582Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 1760671Domain d1u8qb2: 1u8q B:114-216 [113167]
    Other proteins in same PDB: d1u8qa1, d1u8qa2, d1u8qb1

Details for d1u8qb2

PDB Entry: 1u8q (more details), 2.24 Å

PDB Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide ELEKWAS
PDB Compounds: (B:) antibody 2f5 (heavy chain)

SCOPe Domain Sequences for d1u8qb2:

Sequence, based on SEQRES records: (download)

>d1u8qb2 b.1.1.2 (B:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tstkgpsvfplapsskstagaaaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvepksc

Sequence, based on observed residues (ATOM records): (download)

>d1u8qb2 b.1.1.2 (B:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tstkgpsvfplapgaaaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslqtytcnvnhkpsntkvdkrvepksc

SCOPe Domain Coordinates for d1u8qb2:

Click to download the PDB-style file with coordinates for d1u8qb2.
(The format of our PDB-style files is described here.)

Timeline for d1u8qb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u8qb1