SCOP 1.73: Domain d1u8qa1: 1u8q A:1-107

Lineage for d1u8qa1 (1u8q A:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (52 PDB entries)

8. Domain d1u8qa1: 1u8q A:1-107 [113164]
   Other proteins in same PDB: d1u8qa2, d1u8qb1, d1u8qb2

Details for d1u8qa1

PDB Entry: 1u8q, 2.24 Å

PDB Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide ELEKWAS

PDB Compounds: (A:) antibody 2f5 (light chain)

SCOP Domain Sequences for d1u8qa1:

Sequence; same for both SEQRES and ATOM records:

>d1u8qa1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvr

Timeline for d1u8qa1:

• d1u8qa1 first appeared in SCOP 1.71
  
• d1u8qa1 appears in SCOP 1.75
  
• d1u8qa1 appears in the current release, SCOPe 2.08