SCOP 1.73: Domain d1u8pb2: 1u8p B:114-216

Lineage for d1u8pb2 (1u8p B:114-216)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1u8pb2: 1u8p B:114-216 [113163]
   Other proteins in same PDB: d1u8pa1, d1u8pa2, d1u8pb1

Details for d1u8pb2

PDB Entry: 1u8p, 3.23 Å

PDB Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide ECDKWCS

PDB Compounds: (B:) antibody 2f5 (heavy chain)

SCOP Domain Sequences for d1u8pb2:

Sequence, based on SEQRES records:

>d1u8pb2 b.1.1.2 (B:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tstkgpsvfplapsskstagaaaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvepksc

Sequence, based on observed residues (ATOM records):

>d1u8pb2 b.1.1.2 (B:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tstkgpsvfplapgaaaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslqtytcnvnhkpsntkvdkrvepksc

Timeline for d1u8pb2:

• d1u8pb2 first appeared in SCOP 1.71
  
• d1u8pb2 appears in SCOP 1.75
  
• d1u8pb2 appears in the current release, SCOPe 2.08