Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody |
Domain d1u8oa2: 1u8o A:108-214 [113157] Other proteins in same PDB: d1u8oa1, d1u8ob1, d1u8ob2 |
PDB Entry: 1u8o (more details), 3.02 Å
SCOPe Domain Sequences for d1u8oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u8oa2 b.1.1.2 (A:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyecevthqglsspvtksfnrgec
Timeline for d1u8oa2: