SCOP 1.71: Domain d1u8ma2: 1u8m A:107-214

Lineage for d1u8ma2 (1u8m A:107-214)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (100 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1u8ma2: 1u8m A:107-214 [113149]
   Other proteins in same PDB: d1u8ma1, d1u8mb1, d1u8mb2

Details for d1u8ma2

PDB Entry: 1u8m, 2.4 Å

PDB Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide ELDKYAS

SCOP Domain Sequences for d1u8ma2:

Sequence; same for both SEQRES and ATOM records:

>d1u8ma2 b.1.1.2 (A:107-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyecevthqglsspvtksfnrgec

Timeline for d1u8ma2:

• d1u8ma2 is new in SCOP 1.71
  
• d1u8ma2 appears in SCOP 1.73
  
• d1u8ma2 appears in the current release, SCOPe 2.08