Lineage for d1u8cb4 (1u8c B:1532-1562)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258757Family g.3.11.6: Integrin beta EGF-like domains [69940] (1 protein)
  6. 2258758Protein Integrin beta EGF-like domains [69941] (1 species)
  7. 2258759Species Human (Homo sapiens) [TaxId:9606] [69942] (5 PDB entries)
    Uniprot P05106 27-716
  8. 2258766Domain d1u8cb4: 1u8c B:1532-1562 [113123]
    Other proteins in same PDB: d1u8ca1, d1u8ca2, d1u8ca3, d1u8ca4, d1u8cb1, d1u8cb2, d1u8cb3, d1u8cb6
    complexed with ca, nag, ndg

Details for d1u8cb4

PDB Entry: 1u8c (more details), 3.1 Å

PDB Description: a novel adaptation of the integrin psi domain revealed from its crystal structure
PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1u8cb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8cb4 g.3.11.6 (B:1532-1562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}
kgemcsghgqcscgdclcdsdwtgyycnctt

SCOPe Domain Coordinates for d1u8cb4:

Click to download the PDB-style file with coordinates for d1u8cb4.
(The format of our PDB-style files is described here.)

Timeline for d1u8cb4: