SCOP 1.71: Domain d1u8ca2: 1u8c A:599-737

Lineage for d1u8ca2 (1u8c A:599-737)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.15: Integrin domains [69179] (1 family)

5. Family b.1.15.1: Integrin domains [69180] (2 proteins)

6. Protein Thigh, calf-1 and calf-2 domains of integrin alpha [69181] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69182] (4 PDB entries)

8. Domain d1u8ca2: 1u8c A:599-737 [113117]
   Other proteins in same PDB: d1u8ca4, d1u8cb1, d1u8cb2, d1u8cb3, d1u8cb4, d1u8cb5, d1u8cb6

Details for d1u8ca2

PDB Entry: 1u8c, 3.1 Å

PDB Description: a novel adaptation of the integrin psi domain revealed from its crystal structure

SCOP Domain Sequences for d1u8ca2:

Sequence; same for both SEQRES and ATOM records:

>d1u8ca2 b.1.15.1 (A:599-737) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens)}
dnvckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvr
nnealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiq
ssnlfdkvspvvshkvdla

Timeline for d1u8ca2:

• d1u8ca2 is new in SCOP 1.71
  
• d1u8ca2 appears in SCOP 1.73
  
• d1u8ca2 appears in the current release, SCOPe 2.08