Lineage for d1u6gb_ (1u6g B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642222Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2642223Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2642224Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)
  6. 2642257Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species)
  7. 2642258Species Human (Homo sapiens) [TaxId:9606] [75694] (9 PDB entries)
    Uniprot P62877 19-106
  8. 2642265Domain d1u6gb_: 1u6g B: [113065]
    Other proteins in same PDB: d1u6ga1, d1u6ga2, d1u6ga3, d1u6gc_
    complexed with zn

Details for d1u6gb_

PDB Entry: 1u6g (more details), 3.1 Å

PDB Description: Crystal Structure of The Cand1-Cul1-Roc1 Complex
PDB Compounds: (B:) RING-box protein 1

SCOPe Domain Sequences for d1u6gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6gb_ g.44.1.1 (B:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
fhfhcisrwlktrqvcpldnrewefqky

SCOPe Domain Coordinates for d1u6gb_:

Click to download the PDB-style file with coordinates for d1u6gb_.
(The format of our PDB-style files is described here.)

Timeline for d1u6gb_: