Lineage for d1u5va_ (1u5v A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2100061Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2100234Family c.1.12.5: HpcH/HpaI aldolase [51638] (3 proteins)
    forms a swapped dimer; contains a PK-type metal-binding site
  6. 2100241Protein Citrate lyase, beta subunit [110375] (2 species)
    non-swapped trimer
  7. 2100246Species Mycobacterium tuberculosis [TaxId:1773] [117388] (3 PDB entries)
    Uniprot O06162
  8. 2100248Domain d1u5va_: 1u5v A: [113054]
    complexed with atp, fmt

Details for d1u5va_

PDB Entry: 1u5v (more details), 1.85 Å

PDB Description: structure of cite complexed with triphosphate group of atp form mycobacterium tuberculosis
PDB Compounds: (A:) citE

SCOPe Domain Sequences for d1u5va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5va_ c.1.12.5 (A:) Citrate lyase, beta subunit {Mycobacterium tuberculosis [TaxId: 1773]}
mnlraagpgwlfcpadapeafaaaaaaadvvildledgvaaaqkpaarnalrdtpldper
tvvrinaggtadqardlealagtayttvmlpkaesaaqvielaprdvialvetargavca
aeiaaadptvgmmwgaedliatlggsssrradgayrdvarhvrstillaasafgrlalda
vhldildveglqeeardaaavgfdvtvcihpsqipvvrkayaa

SCOPe Domain Coordinates for d1u5va_:

Click to download the PDB-style file with coordinates for d1u5va_.
(The format of our PDB-style files is described here.)

Timeline for d1u5va_: