Lineage for d1u5va_ (1u5v A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 573147Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 573257Family c.1.12.5: HpcH/HpaI aldolase [51638] (3 proteins)
    forms a swapped dimer; contains a PK-type metal-binding site
  6. 573264Protein Citrate lyase, beta subunit [110375] (2 species)
    non-swapped trimer
  7. 573267Species Mycobacterium tuberculosis [TaxId:1773] [117388] (2 PDB entries)
  8. 573269Domain d1u5va_: 1u5v A: [113054]
    complexed with atp, fmt; mutant

Details for d1u5va_

PDB Entry: 1u5v (more details), 1.85 Å

PDB Description: structure of cite complexed with triphosphate group of atp form mycobacterium tuberculosis

SCOP Domain Sequences for d1u5va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5va_ c.1.12.5 (A:) Citrate lyase, beta subunit {Mycobacterium tuberculosis}
mnlraagpgwlfcpadapeafaaaaaaadvvildledgvaaaqkpaarnalrdtpldper
tvvrinaggtadqardlealagtayttvmlpkaesaaqvielaprdvialvetargavca
aeiaaadptvgmmwgaedliatlggsssrradgayrdvarhvrstillaasafgrlalda
vhldildveglqeeardaaavgfdvtvcihpsqipvvrkayaa

SCOP Domain Coordinates for d1u5va_:

Click to download the PDB-style file with coordinates for d1u5va_.
(The format of our PDB-style files is described here.)

Timeline for d1u5va_: