Lineage for d1u2vg_ (1u2v G:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 776088Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family) (S)
  5. 776089Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (1 protein)
  6. 776090Protein Arp2/3 complex 16 kDa subunit ARPC5 [69105] (1 species)
  7. 776091Species Cow (Bos taurus) [TaxId:9913] [69106] (10 PDB entries)
    Uniprot Q9CPW4 # 99% sequence identity
  8. 776094Domain d1u2vg_: 1u2v G: [112996]
    Other proteins in same PDB: d1u2va1, d1u2va2, d1u2vb1, d1u2vc_, d1u2vd1, d1u2vd2, d1u2ve_, d1u2vf_
    complexed with adp, ca

Details for d1u2vg_

PDB Entry: 1u2v (more details), 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ADP and calcium
PDB Compounds: (G:) Arp2/3 Complex 16kDa Subunit

SCOP Domain Sequences for d1u2vg_:

Sequence, based on SEQRES records: (download)

>d1u2vg_ a.118.13.1 (G:) Arp2/3 complex 16 kDa subunit ARPC5 {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvdeydenkfvdeddggdgqagpdegevdsclrqgnmtaalqaalknppintks
qavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqw
hekalaaggvgsivrvltarktv

Sequence, based on observed residues (ATOM records): (download)

>d1u2vg_ a.118.13.1 (G:) Arp2/3 complex 16 kDa subunit ARPC5 {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvdeydenkfvdagpdegevdsclrqgnmtaalqaalknppintksqavkdrag
sivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekalaag
gvgsivrvltarktv

SCOP Domain Coordinates for d1u2vg_:

Click to download the PDB-style file with coordinates for d1u2vg_.
(The format of our PDB-style files is described here.)

Timeline for d1u2vg_: