Lineage for d1u2vd2 (1u2v D:121-282)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879922Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 879991Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 879992Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)
  6. 879993Protein ARPC2 (34 kDa subunit) [69649] (1 species)
    duplication: tandem repeat of two domains of this fold
  7. 879994Species Cow (Bos taurus) [TaxId:9913] [69650] (10 PDB entries)
    Uniprot O15144 1-282 # 100% sequence identity
  8. 880000Domain d1u2vd2: 1u2v D:121-282 [112993]
    Other proteins in same PDB: d1u2va1, d1u2va2, d1u2vb1, d1u2vc_, d1u2ve_, d1u2vf_, d1u2vg_
    complexed with adp, ca

Details for d1u2vd2

PDB Entry: 1u2v (more details), 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ADP and calcium
PDB Compounds: (D:) Arp2/3 complex 34kDa subunit

SCOP Domain Sequences for d1u2vd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2vd2 d.198.2.1 (D:121-282) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt
inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarp

SCOP Domain Coordinates for d1u2vd2:

Click to download the PDB-style file with coordinates for d1u2vd2.
(The format of our PDB-style files is described here.)

Timeline for d1u2vd2: