Lineage for d1u2vc_ (1u2v C:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565655Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 565717Superfamily b.69.4: WD40 repeat-like [50978] (2 families) (S)
    also contains 8-bladed propellers
  5. 565718Family b.69.4.1: WD40-repeat [50979] (8 proteins)
  6. 565736Protein Arp2/3 complex 41 kDa subunit ARPC1 [69313] (1 species)
  7. 565737Species Cow (Bos taurus) [TaxId:9913] [69314] (3 PDB entries)
  8. 565739Domain d1u2vc_: 1u2v C: [112991]
    Other proteins in same PDB: d1u2va1, d1u2va2, d1u2vb1, d1u2vd1, d1u2vd2, d1u2ve_, d1u2vf_, d1u2vg_
    complexed with adp, ca

Details for d1u2vc_

PDB Entry: 1u2v (more details), 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ADP and calcium

SCOP Domain Sequences for d1u2vc_:

Sequence, based on SEQRES records: (download)

>d1u2vc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus)}
ayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgvdwa
pdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvis
icyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerpa
ptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatla
setlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpkqssqrgltarer
fqnldkkassegsaaagagldslhknsvsqisvlsggkakcsqfcttgmdggmsiwdvrs
lesalkdlkiv

Sequence, based on observed residues (ATOM records): (download)

>d1u2vc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus)}
ayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgvdwa
pdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvis
icyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerpa
ptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatla
setlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvprgltarerfqnld
kkaagldslhknsvsqisvlsggkakcsqfcttgmdggmsiwdvrslesalkdlkiv

SCOP Domain Coordinates for d1u2vc_:

Click to download the PDB-style file with coordinates for d1u2vc_.
(The format of our PDB-style files is described here.)

Timeline for d1u2vc_: