SCOPe 2.05: Domain d1u2jg_: 1u2j G:

Lineage for d1u2jg_ (1u2j G:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.3: Catalase-peroxidase KatG [74753] (2 proteins)
   duplication: tandem repeat of two CCP-like domains

6. Protein Catalase-peroxidase KatG [74754] (4 species)
   only the N-terminal CCP-like domain binds heme

7. Species Burkholderia pseudomallei [TaxId:28450] [89093] (21 PDB entries)
   Uniprot P13029 Q939D2 35-748

8. Domain d1u2jg_: 1u2j G: [112981]
   C-domain only

Details for d1u2jg_

PDB Entry: 1u2j, 2.3 Å

PDB Description: Crystal structure of the C-terminal domain from the catalase-peroxidase KatG of Escherichia coli (P21 21 21)

PDB Compounds: (G:) Peroxidase/catalase HPI

SCOPe Domain Sequences for d1u2jg_:

Sequence; same for both SEQRES and ATOM records:

>d1u2jg_ a.93.1.3 (G:) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]}
liwqdplpqpiynpteqdiidlkfaiadsglsvselvsvawasastfrggdkrggangar
lalmpqrdwdvnaaavralpvlekiqkesgkasladiivlagvvgvekaasaaglsihvp
fapgrvdarqdqtdiemfellepiadgfrnyrarldvsttesllidkaqqltltapemta
lvggmrvlganfdgskngvftdrvgvlsndffvnlldmryewkatdeskelfegrdretg
evkftasradlvfgsnsvlravaevyassdahekfvkdfvaawvkvmnldrfdll

Timeline for d1u2jg_:

• d1u2jg_ first appeared in SCOP 1.71
  
• d1u2jg_ appears in SCOPe 2.04
  
• d1u2jg_ appears in SCOPe 2.06
  
• d1u2jg_ appears in the current release, SCOPe 2.08