SCOP 1.71: Domain d1u0wc2: 1u0w C:235-389

Lineage for d1u0wc2 (1u0w C:235-389)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)

6. Protein Chalcone synthase [53915] (1 species)

7. Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (16 PDB entries)

8. Domain d1u0wc2: 1u0w C:235-389 [112943]

Details for d1u0wc2

PDB Entry: 1u0w, 2 Å

PDB Description: an aldol switch discovered in stilbene synthases mediates cyclization specificity of type iii polyketide synthases: 18xchs+resveratrol structure

SCOP Domain Sequences for d1u0wc2:

Sequence; same for both SEQRES and ATOM records:

>d1u0wc2 c.95.1.2 (C:235-389) Chalcone synthase {Alfalfa (Medicago sativa)}
pifemvwtaqtiapdsegaidghlreagltfhlkgavpdivsknitkalveafeplgisd
ynsifwiahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkst
qnglkttgeglewgvlfgfgpgltietvvlrsvai

Timeline for d1u0wc2:

• d1u0wc2 is new in SCOP 1.71
  
• d1u0wc2 appears in SCOP 1.73
  
• d1u0wc2 appears in the current release, SCOPe 2.08