SCOPe 2.08: Domain d1u0uc2: 1u0u C:238-393

Lineage for d1u0uc2 (1u0u C:238-393)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)

6. Protein Dihydropinosylvin synthase, C-terminal domain [419033] (1 species)
7. Species Scots pine (Pinus sylvestris) [TaxId:3349] [419517] (1 PDB entry)
   Uniprot Q02323

8. Domain d1u0uc2: 1u0u C:238-393 [112927]
   Other proteins in same PDB: d1u0ua1, d1u0ub1, d1u0uc1, d1u0ud1, d1u0ue1, d1u0uf1

Details for d1u0uc2

PDB Entry: 1u0u, 2.11 Å

PDB Description: an aldol switch discovered in stilbene synthases mediates cyclization specificity of type iii polyketide synthases: pine stilbene synthase structure

PDB Compounds: (C:) Dihydropinosylvin synthase

SCOPe Domain Sequences for d1u0uc2:

Sequence; same for both SEQRES and ATOM records:

>d1u0uc2 c.95.1.2 (C:238-393) Dihydropinosylvin synthase, C-terminal domain {Scots pine (Pinus sylvestris) [TaxId: 3349]}
acfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisd
wnklfwvvhpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkasl
qngcsttgeglemgvlfgfgpgltietvvlksvpiq

Timeline for d1u0uc2:

• d1u0uc2 first appeared in SCOP 1.71
  
• d1u0uc2 appears in SCOPe 2.07