Lineage for d1tz2d_ (1tz2 D:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 591978Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 591979Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 591980Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (7 proteins)
  6. 591981Protein 1-aminocyclopropane-1-carboxylate deaminase [53694] (3 species)
  7. 592010Species Pseudomonas sp., strain ACP [TaxId:306] [110722] (6 PDB entries)
  8. 592026Domain d1tz2d_: 1tz2 D: [112859]
    complexed with 1ac, plp

Details for d1tz2d_

PDB Entry: 1tz2 (more details), 2.1 Å

PDB Description: Crystal structure of 1-aminocyclopropane-1-carboyxlate deaminase complexed with ACC

SCOP Domain Sequences for d1tz2d_:

Sequence, based on SEQRES records: (download)

>d1tz2d_ c.79.1.1 (D:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP}
mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
ilgadvrlvpdgfdigfrrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevr
aqeaelgfkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriar
qtaekvglerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmh
gmiemvrngefpegsrvlyahlggvpalngysfifrdg

Sequence, based on observed residues (ATOM records): (download)

>d1tz2d_ c.79.1.1 (D:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP}
mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
ilgadvrlvrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevraqeaelgfk
fdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriarqtaekvgle
rdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmhgmiemvrng
efpegsrvlyahlggvpalngysfifrdg

SCOP Domain Coordinates for d1tz2d_:

Click to download the PDB-style file with coordinates for d1tz2d_.
(The format of our PDB-style files is described here.)

Timeline for d1tz2d_: