Lineage for d1tyqf_ (1tyq F:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879922Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 879991Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 879992Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)
  6. 880015Protein ARPC4 (20 kDa subunit) [69647] (1 species)
  7. 880016Species Cow (Bos taurus) [TaxId:9913] [69648] (10 PDB entries)
    Uniprot P59998 # 100% sequence identity
  8. 880021Domain d1tyqf_: 1tyq F: [112848]
    Other proteins in same PDB: d1tyqa1, d1tyqa2, d1tyqb1, d1tyqc_, d1tyqd1, d1tyqd2, d1tyqe_, d1tyqg_
    complexed with atp, ca

Details for d1tyqf_

PDB Entry: 1tyq (more details), 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ATP and calcium
PDB Compounds: (F:) Arp2/3 complex 20kDa subunit

SCOP Domain Sequences for d1tyqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyqf_ d.198.2.1 (F:) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
atlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekvl
iegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnfh
teqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf

SCOP Domain Coordinates for d1tyqf_:

Click to download the PDB-style file with coordinates for d1tyqf_.
(The format of our PDB-style files is described here.)

Timeline for d1tyqf_: