Lineage for d1tyqe_ (1tyq E:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 545252Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily)
    5 helices; one helix is surrounded by the others
  4. 545253Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) (S)
  5. 545254Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (1 protein)
  6. 545255Protein Arp2/3 complex 21 kDa subunit ARPC3 [69062] (1 species)
  7. 545256Species Cow (Bos taurus) [TaxId:9913] [69063] (3 PDB entries)
  8. 545259Domain d1tyqe_: 1tyq E: [112847]
    Other proteins in same PDB: d1tyqa1, d1tyqa2, d1tyqb1, d1tyqc_, d1tyqd1, d1tyqd2, d1tyqf_, d1tyqg_
    complexed with atp, ca

Details for d1tyqe_

PDB Entry: 1tyq (more details), 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ATP and calcium

SCOP Domain Sequences for d1tyqe_:

Sequence, based on SEQRES records: (download)

>d1tyqe_ a.148.1.1 (E:) Arp2/3 complex 21 kDa subunit ARPC3 {Cow (Bos taurus)}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnksls

Sequence, based on observed residues (ATOM records): (download)

>d1tyqe_ a.148.1.1 (E:) Arp2/3 complex 21 kDa subunit ARPC3 {Cow (Bos taurus)}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdkpskwwtcfvkrqfmnksls

SCOP Domain Coordinates for d1tyqe_:

Click to download the PDB-style file with coordinates for d1tyqe_.
(The format of our PDB-style files is described here.)

Timeline for d1tyqe_: