Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
Protein Actin-related protein 2, Arp2 [69530] (1 species) part of Arp2/3 complex |
Species Cow (Bos taurus) [TaxId:9913] [69531] (3 PDB entries) Uniprot P61160 143-350 # 100% sequence identity |
Domain d1tyqb1: 1tyq B:147-350 [112843] Other proteins in same PDB: d1tyqa1, d1tyqa2, d1tyqc_, d1tyqd1, d1tyqd2, d1tyqe_, d1tyqf_, d1tyqg_ only the second half is ordered complexed with atp, ca |
PDB Entry: 1tyq (more details), 2.55 Å
SCOPe Domain Sequences for d1tyqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tyqb1 c.55.1.1 (B:147-350) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} yaqglltgvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnh sadfetvrmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealf qphlinvegvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlyl ervlkgdveklskfkiriedpprr
Timeline for d1tyqb1: