Lineage for d1tyqa2 (1tyq A:161-418)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 835946Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 835947Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 836098Protein Actin-related protein 3, Arp3 [69528] (1 species)
    part of Arp2/3 complex
  7. 836099Species Cow (Bos taurus) [TaxId:9913] [69529] (10 PDB entries)
    Uniprot P61158
  8. 836109Domain d1tyqa2: 1tyq A:161-418 [112842]
    Other proteins in same PDB: d1tyqb1, d1tyqc_, d1tyqd1, d1tyqd2, d1tyqe_, d1tyqf_, d1tyqg_
    complexed with atp, ca

Details for d1tyqa2

PDB Entry: 1tyq (more details), 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ATP and calcium
PDB Compounds: (A:) Actin-related protein 3

SCOP Domain Sequences for d1tyqa2:

Sequence, based on SEQRES records: (download)

>d1tyqa2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
rtltgtvidsgdgvthvipvaegyvigscikhipiagrdityfiqqllrdrevgippeqs
letakavkerysyvcpdlvkefnkydtdgskwikqytginaiskkefsidvgyerflgpe
iffhpefanpdftqpisevvdeviqncpidvrrplyknivlsggstmfrdfgrrlqrdlk
rtvdarlklseelsggrlkpkpidvqvithhmqryavwfggsmlastpefyqvchtkkdy
eeigpsicrhnpvfgvms

Sequence, based on observed residues (ATOM records): (download)

>d1tyqa2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
rtltgtvidsgdgvthvipvaegyvigscikhipiagrdityfiqqllrdrevgippeqs
letakavkerysyvcpdlvkefnkydtdgskwikqytginaiskkefsidvgyerflgpe
iffhpefanpdftqpisevvdeviqncpidvrrplyknivlsggstmfrdfgrrlqrdlk
rtvdarlklseelpkpidvqvithhmqryavwfggsmlastpefyqvchtkkdyeeigps
icrhnpvfgvms

SCOP Domain Coordinates for d1tyqa2:

Click to download the PDB-style file with coordinates for d1tyqa2.
(The format of our PDB-style files is described here.)

Timeline for d1tyqa2: